PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039902
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 245aa    MW: 27709 Da    PI: 7.426
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039902genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.96.1e-101171521348
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                  NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  Lus10039902 117 NRQSAQRSRVRKLQYISELERSVTSLQAEVSVLSPR 152
                  ****************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-7106169IPR004827Basic-leucine zipper domain
PROSITE patternPS000360112127IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-9112161No hitNo description
CDDcd147031.00E-20112160No hitNo description
Gene3DG3DSA:1.20.5.1704.8E-9115160No hitNo description
PfamPF001701.7E-7116153IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MAHLPPKIPT TMLPSWPDFS SDHKLMHSPS AAVPPPSSAA NNNKPSWVDE FLDFSSSRRG  60
NHRRSVSDGS VAFLEVPMLD DGHHHRDFER FADETFTSIT IVIIPTGLWT PREILANRQS  120
AQRSRVRKLQ YISELERSVT SLQAEVSVLS PRVAFLDHQR LLLNVDNSAL KQRIAALAQD  180
KMFKDAHQEA LKREIERLRE VYHQQQQNLK NMDSNNNSSS SSGQANEQPN ITAEKEQQQQ  240
LLQV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010279202.11e-70PREDICTED: basic leucine zipper 61-like
SwissprotF4IN231e-55BZP34_ARATH; Basic leucine zipper 34
SwissprotQ9M2K41e-55BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A078C2C03e-84A0A078C2C0_BRANA; BnaC03g10840D protein
STRINGGLYMA12G35650.27e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2157844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-55bZIP family protein